DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pax6a and al

DIOPT Version :9

Sequence 1:XP_009296153.1 Gene:pax6a / 30567 ZFINID:ZDB-GENE-990415-200 Length:459 Species:Danio rerio
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:268 Identity:90/268 - (33%)
Similarity:120/268 - (44%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish   205 PGTSVP--------------GQPNQDGCQQSDGGGENTNSISSNGEDSDETQMRLQLKRKLQRNR 255
            ||:|..              |.|:  |...:.||   |||..|:| :||........|||.:|.|
  Fly    31 PGSSAASAGAALTVSMSVSGGAPS--GASGASGG---TNSPVSDG-NSDCEADEYAPKRKQRRYR 89

Zfish   256 TSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQAS 320
            |:||..|:|.|||.|.||||||||.||.||.||.|.||||||||.|||||||::||:..|     
  Fly    90 TTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQ----- 149

Zfish   321 NSSSHIPISSSFSTSVYQP-IPQPTTPVSFTSGSMLGRSDTALTNTYSALPPMPSFTMANNL--P 382
               ||          .|.| :|              |.:.|..|...:||||.|...:...|  |
  Fly   150 ---SH----------PYNPYLP--------------GGAATMQTVVGAALPPNPFTHLGFQLRKP 187

Zfish   383 MQPSQTSSYSCM----LPTSPSVNGRSYDTY--TPPHMQAHMNSQSMAASGTTSTGLISPGVSVP 441
            ......::.:..    |..:|.:....::.:  .||||..| ....|.:..::...|::...:||
  Fly   188 FDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPH-GMAGMYSPSSSFQSLLANMTAVP 251

Zfish   442 VQVPGSEP 449
            ...|..:|
  Fly   252 RGTPLGKP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pax6aXP_009296153.1 PAX 31..169 CDD:128645
Homeobox 255..307 CDD:306543 38/51 (75%)
Retinal 341..>459 CDD:330657 24/117 (21%)
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.