DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HCK and skb5

DIOPT Version :9

Sequence 1:	NP_002101.2	Gene:	HCK / 3055	HGNCID:	4840	Length:	526	Species:	Homo sapiens
Sequence 2:	NP_588016.1	Gene:	skb5 / 2539237	PomBaseID:	SPCC24B10.13	Length:	140	Species:	Schizosaccharomyces pombe

Alignment Length:	51	Identity:	19/51 - (37%)
Similarity:	30/51 - (58%)	Gaps:	1/51 - (1%)

- Green bases have known domain annotations that are detailed below.

Human    84 VALYDYEAIHHEDLSFQKGDQMVVLEESGEWWK-ARSLATRKEGYIPSNYV 133
            |||||:|.:|..:|.|..|.::.:|.||.:.|. |...|:.:.|.:|..:|
pombe    86 VALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFV 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HCK	NP_002101.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		SH3	82..137	CDD:302595	19/51 (37%)
		SH2_Src_HCK	140..243	CDD:198226
		PKc_like	254..524	CDD:304357
		Pkinase_Tyr	262..511	CDD:285015
skb5	NP_588016.1	SH3_Nbp2-like	84..138	CDD:212799	19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	42	1.000	Domainoid score	I4126
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000006
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910