DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxd3 and FoxK

DIOPT Version :9

Sequence 1:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:206 Identity:70/206 - (33%)
Similarity:92/206 - (44%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish    96 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYR-EKFPAWQNSIRHNLSLNDCFVKIPR 159
            ||||||..||..||..:|.|:||||||..||...:|||| |....||||||||||||..|:|:.|
  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517

Zfish   160 EPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQPDILRDQTALMMQSFGAYGIGNPYGRHY 224
            ....||||::|.:||.|.....:.|:.:||:|                    .:.|...|||   
  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR--------------------SSQGFRPPYG--- 559

Zfish   225 GIHPAAYTHPAALQYPYIPPVGPMLPPAVPLLPSAELNRKAFSSQLSPSLQLQLNSLSTASIIKS 289
                                    :|.:.|:.||...|    |.:.||...:         :::|
  Fly   560 ------------------------MPRSAPVSPSHMDN----SRESSPLQDI---------VLQS 587

Zfish   290 EPSSRPSFSIE 300
            .|.| |..|:|
  Fly   588 APGS-PGMSLE 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 48/86 (56%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 48/86 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.