DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pou3f2a and pdm2

DIOPT Version :9

Sequence 1:NP_571364.1 Gene:pou3f2a / 30547 ZFINID:ZDB-GENE-980526-139 Length:337 Species:Danio rerio
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:264 Identity:124/264 - (46%)
Similarity:149/264 - (56%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


Zfish    68 SPWPASPLGEQDIKPVEELQHSPRQAHLVPQSQHHETAAW-RATTTAHMPSMSTSNGQSLIYSQP 131
            :|...|||....:.||.  :||..|....|.|....:... .|..|.:.|||...........:|
  Fly   601 TPLAKSPLRSPSLSPVP--RHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKP 663

Zfish   132 GYGEMHHEEHHSPHLSEHGHPQSL-HSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL 195
            ..|           |:.......| .|.|:|...::||||||.||||||||||||.|||||:|.|
  Fly   664 TSG-----------LTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKL 717

Zfish   196 YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADST------------------SGSPTSL 242
            |||.||||||.|||||.|||||||||||||.||||:||||                  |.:|.|:
  Fly   718 YGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESI 782

Zfish   243 DKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPGASEINSLADSLQLEKEVVRVWFCNRRQKEK 307
                 .||:||||||||.:|:..||..||...||.:.||:.|::.|.::|||:||||||||||||
  Fly   783 -----LGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEK 842

Zfish   308 RMTP 311
            |:.|
  Fly   843 RINP 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pou3f2aNP_571364.1 POU 159..233 CDD:197673 58/73 (79%)
Homeobox 254..307 CDD:278475 30/52 (58%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 54/63 (86%)
Homeobox 789..842 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.