DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sox17 and cic

DIOPT Version :9

Sequence 1:NP_571362.2 Gene:sox17 / 30544 ZFINID:ZDB-GENE-991213-1 Length:413 Species:Danio rerio
Sequence 2:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster


Alignment Length:421 Identity:98/421 - (23%)
Similarity:159/421 - (37%) Gaps:82/421 - (19%)


- Green bases have known domain annotations that are detailed below.


Zfish    36 LSPLSDSKSKHEKCSAAGPGRGK-SEPRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGK 99
            ||.|...:.:.::..|||...|: :..:|||||||||:::|..||.:.:::|:..|..:||:||:
  Fly  1204 LSALQQQQQQQQQAGAAGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGE 1268

Zfish   100 SWKALPMVDKRPFVEEAERLRVKHMQDHPNYKY--RPRRRKQVKRNKRLEPSFPLPGMCDAKMTL 162
            .|.||....|..:.|.|..::..|.:.||.:|:  :.||:...........:....|..|||..|
  Fly  1269 WWYALKPEQKAQYHELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRL 1333

Zfish   163 -------------C--TEGMSAGYSGAGLPQYCENHTL---FESYSLPTPDPSPMDAGTTEFF-- 207
                         |  |.|.|....|.|:....:...:   .::|: .|.|.:|    ||...  
  Fly  1334 VSVDGSDSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYN-STCDEAP----TTISMKG 1393

Zfish   208 ---AQLQDQSAFSYHHQQ----EHHFQEQTNILNDTHCHGNTQ------------------TLKS 247
               .:|......|...:|    |...|:||....|.||.....                  ..:|
  Fly  1394 NGNGKLMKNELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDYRKQQPEANQRS 1458

Zfish   248 RQSHSIAYSN---INTNTNSNLHAPINAQLSSINLQQVFHENANPQISHHPGTHLNIFNRSPSSS 309
            .:.||.:.:|   ||....|.....|..:..:|....|...|..|.      |.::|:.:..|..
  Fly  1459 AEEHSTSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPY------TQMSIYTQYTSPK 1517

Zfish   310 SHHAMTP------AYLNCPSTLDTFYNSSSQMKELSHCVSSHTHKQQSIAEAQSQASTATHSSGQ 368
            :...:||      |:.:.|.:    ...|....|.:..:.:|. ||:.|.:.........:.||.
  Fly  1518 NPIGVTPFQPTGGAFKSMPIS----PKGSGGKPEDAGSLQAHI-KQEDIKQEPPSPYKLNNGSGS 1577

Zfish   369 MVDEVEFEHCLSFGVPSAPLPGSDLISTVLS 399
                     ....||.|||.|.|..:..:.:
  Fly  1578 ---------ASGGGVVSAPPPNSGSVGAIFN 1599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sox17NP_571362.2 SOX-TCF_HMG-box 62..133 CDD:238684 28/72 (39%)
Sox_C_TAD 186..411 CDD:288887 50/250 (20%)
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 28/70 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.