DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sox21a and Sox100B

DIOPT Version :9

Sequence 1:NP_571361.1 Gene:sox21a / 30543 ZFINID:ZDB-GENE-990715-6 Length:239 Species:Danio rerio
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:249 Identity:75/249 - (30%)
Similarity:110/249 - (44%) Gaps:66/249 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish     6 DHVKRPMNAFMVWSRAQRRKMALDNPKMHNSEISKRLGGEWKLLSDSEKRPFIDEAKRLRAVHMK 70
            :|:||||||||||::|.||.|:...|.:.|||:||.||..||.|.||:|:||::.|::||..|.:
  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139

Zfish    71 EHPDYKYRPRRKPKNLIKKDRY--------HFNVTYNLGEGDPLKSARLS-------GDALSDSL 120
            |||||||:||||...::...:.        ...::..:|.....:|:..:       |:|.:|..
  Fly   140 EHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLG 204

Zfish   121 SAEKT----SVAAAATRVFFSHHLSANPYPFLDLN------------------------SKISEL 157
            |...|    :|.:.::.||      :|......||                        |.:|.|
  Fly   205 SCASTISHANVGSNSSDVF------SNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSL 263

Zfish   158 PPAPFPH--------YSVLGYPSGL---------PAFPGMGVLAGAPHAHPSAG 194
            .|...|:        .|....||.|         .|..|.|||..|...:.:.|
  Fly   264 TPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sox21aNP_571361.1 SOX-TCF_HMG-box 7..78 CDD:238684 41/70 (59%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.