DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxb1a and FoxK

DIOPT Version :9

Sequence 1:NP_571360.1 Gene:foxb1a / 30542 ZFINID:ZDB-GENE-990616-47 Length:297 Species:Danio rerio
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:307 Identity:86/307 - (28%)
Similarity:117/307 - (38%) Gaps:109/307 - (35%)


- Green bases have known domain annotations that are detailed below.


Zfish     4 PGRNTYS-DQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQR-WQNSLRHNLS 66
            |...:|: ::||||||..|...||.:.|:|.|.||.||.||:..:||||:.|.: ||||:|||||
  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507

Zfish    67 FNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVMTSEHLAPSKPSDAAHYLQQ 131
            .|..|||:.|..|:|||||||.:.|..|....:.|:.:||:|                       
  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR----------------------- 549

Zfish   132 HAKLRLSALGTHLPQMSSYNLGVSQPSTFKHPFAIENIIAREYKVPGGLAFSTGYPLHNQLTTAW 196
                  |:.|                  |:.|:.                               
  Fly   550 ------SSQG------------------FRPPYG------------------------------- 559

Zfish   197 PHMYSTSMMDSAAPISMTSSDYSAYGVPIKSLCHGGQTLPAIPVPIKPTPAALPHHI-------- 253
                    |..:||:|.:..|.|....|::.:..  |:.|..|.......||.|..|        
  Fly   560 --------MPRSAPVSPSHMDNSRESSPLQDIVL--QSAPGSPGMSLEQRAADPEIIYNSQNAHQ 614

Zfish   254 ----------PAFLSNSPQSLSPTSPQTATSQSS-PATPSETLTGPA 289
                      ...|||:....|..||...|:||| .|||...:.|.|
  Fly   615 QQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQTHVEGSA 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxb1aNP_571360.1 FH 13..101 CDD:214627 47/88 (53%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.