DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pax3a and Poxm

DIOPT Version :9

Sequence 1:NP_571352.1 Gene:pax3a / 30532 ZFINID:ZDB-GENE-980526-52 Length:509 Species:Danio rerio
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:444 Identity:149/444 - (33%)
Similarity:188/444 - (42%) Gaps:103/444 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish    36 GRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA 100
            |.||||||||:|||||||..|.:|||:|..|||||.||||||||||||||||.||.|||||.|||
  Fly    11 GEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGA 75

Zfish   101 IGGSKPKQSTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDGICDRNNVPSVSSISRMLRCKFGGN 165
            ||||||: .|||.|...|.|.|:.:||:|:|||||:||.:||||:.||||||||||:||.|.|..
  Fly    76 IGGSKPR-VTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSL 139

Zfish   166 GDEDEDDDEVEKREIEENERRAKHSIDGILGDRSSHSDEGSDVDSEPGLPLKRKQRRSRTTFTAE 230
            |.:                    |:...::|  |..|..|..|.|..|      |....:.....
  Fly   140 GHQ--------------------HTPGTVMG--SGSSSGGGSVSSNGG------QNNGTSASNNI 176

Zfish   231 QLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGF 295
            .|..|.......|:|..:...:.|..|                     |.|:.:.|..|      
  Fly   177 NLSNLGNPGGGPHHPHHHHHHQSAAAA---------------------ASAHHVHAHAH------ 214

Zfish   296 PPSAMSSLQPYQLADSPYPPSSISQVSEQPSTVHRPQPLPPTSVHQSGLGSGPGAQEGSSAYCLS 360
                    ....|.:|.|.|.|.:......:....|.  ||...  .|.||.|...:..|....:
  Fly   215 --------AHAHLYNSIYQPYSAAAAYSMKTPCGSPS--PPQGA--GGQGSVPHPHQLRSVAAAA 267

Zfish   361 SGRHGFSGYSDGYVAAPGHANPVNPSISNGLPSQVMGLLNPGAVPHQPQSDFALSPLTGGLEPST 425
            :..|..|.:|...:.|...|..:..|...|:....||.:..           .:|||     |.|
  Fly   268 AAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMGGMGS-----------TVSPL-----PMT 316

Zfish   426 GMPASCHSSQRLEALPGLPSMPALPSSQSYCPSSYSSPGYSVDHVASYQYSQYG 479
            ..|.:..:.       |.|.:.....:....|.:|            |.|.|.|
  Fly   317 PSPVAGTAG-------GQPLLDCEGGAGQQSPYNY------------YMYFQNG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pax3aNP_571352.1 PAX 34..159 CDD:128645 89/122 (73%)
Homeobox 223..276 CDD:278475 6/52 (12%)
Pax7 350..394 CDD:289156 8/43 (19%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 89/122 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.