DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sox3 and Sox15

DIOPT Version :9

Sequence 1:NP_001001811.2 Gene:sox3 / 30529 ZFINID:ZDB-GENE-980526-333 Length:300 Species:Danio rerio
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:268 Identity:80/268 - (29%)
Similarity:122/268 - (45%) Gaps:77/268 - (28%)


- Green bases have known domain annotations that are detailed below.


Zfish    23 GGKNNSANDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLTDAEKRPFIDE 87
            ||..:.:..:.|::|||||||||::.:|:|:|.|||.:||:::||.||..|:.||..::||:::|
  Fly   203 GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEE 267

Zfish    88 AKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLPGGLLAPGANAVNNAVSVGQRMDYTHMNGWT 152
            |:|||.:||.|||:|||||||:.::.|:         .:.||          |:....:..|..|
  Fly   268 AERLRVIHMTEHPNYKYRPRRRKQSKLR---------AMQPG----------GKEQSESSPNPGT 313

Zfish   153 NSAYSLMQDQLAYPQHPSMNSP-----------QIQQMHRYDMAGLQY--PMM-----STAQTYM 199
            ..:.|  ..:||.|...:.:|.           ...|.|.....|..|  |:.     |:...|.
  Fly   314 GGSKS--NPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVDCYS 376

Zfish   200 NAASTYSSMSPAYTQQTSSAMGLGSMASVCKTEPSSPPPAITSHSQRACLGDLRDMISMYLPPGG 264
            ||.||..               :.|:|:.|       |||:.:.|.                |.|
  Fly   377 NADSTEQ---------------IESLAANC-------PPALLNESS----------------PTG 403

Zfish   265 DSADHSSL 272
            ...|:|.|
  Fly   404 GGYDNSLL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sox3NP_001001811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 2/11 (18%)
SOX-TCF_HMG-box 34..105 CDD:238684 39/70 (56%)
SOXp 104..182 CDD:289133 18/88 (20%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.