DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxd2 and FoxK

DIOPT Version :9

Sequence 1:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:378 Identity:93/378 - (24%)
Similarity:128/378 - (33%) Gaps:134/378 - (35%)


- Green bases have known domain annotations that are detailed below.


Zfish    35 HHLSFHLDNDSDD------------NLSQNAGEGAISPGQSSL--------------------DC 67
            ||.:.|.......            :|....|.|..||.:.|:                    .|
  Fly   348 HHTALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSC 412

Zfish    68 PA-----------DRVGQRDDSRTGAL--TGDKPGKNALVKPPYSYIALITMAILQSPKKRLTLS 119
            ||           :......::.|..|  |......|...||||||..||..||..:|.|:||||
  Fly   413 PASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLS 477

Zfish   120 EICEFISNRFPYYR-EKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 183
            .|..||...:|||| |....||||||||||||..|:|:.|....||||::|.:||:|.....:.|
  Fly   478 GIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHS 542

Zfish   184 FLRRRKRFKRHQTNEILREAGGFLPGFGYGPYGYNYGLQLQNFHAHHPYHPHHPGSAFPFQNTHC 248
            :.:||:           |.:.||.|     |||         .....|..|.|      ..|:..
  Fly   543 YKKRRQ-----------RSSQGFRP-----PYG---------MPRSAPVSPSH------MDNSRE 576

Zfish   249 ALPTPSSIFSTPHSLPSFLGTELRKPFYPQLSPTLPGLAPLKTDTNGPSRPSFSIDNIIGAASSP 313
            :.|....:..                                   :.|..|..|::.   .|:.|
  Fly   577 SSPLQDIVLQ-----------------------------------SAPGSPGMSLEQ---RAADP 603

Zfish   314 ASPYTTQPAGQAQILAMLTPTLASATNHLSITQETMLQPGTQTFSSKTSSLNN 366
            ...|.:|.|.|.|                   |:...|...||.|:.::..::
  Fly   604 EIIYNSQNAHQQQ-------------------QQQQQQQQQQTLSNNSNQYSS 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 47/86 (55%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.