DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment irx3a and achi

DIOPT Version :9

Sequence 1:NP_001307054.1 Gene:irx3a / 30520 ZFINID:ZDB-GENE-991119-5 Length:454 Species:Danio rerio
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:285 Identity:65/285 - (22%)
Similarity:92/285 - (32%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish   108 RPKNATRESTSTLKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT 172
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|      
  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------ 154

Zfish   173 PRSRTDEEGNVYNSDHEGDDGDKREDEEEIDLENIDTENIENKDDLDEQDELHSDL--------- 228
               ....|||                                       |.||..:         
  Fly   155 ---MIRREGN---------------------------------------DPLHFTISRRGKKVSP 177

Zfish   229 ----------KLDGRSDSEISDGYEDLQGPEQRLFKAMVKDGK-EIHGDRAEHFHHHSHHHHLHH 282
                      .|.|.:.:..|...|.:.|..:.:      ||. |||...|....:...:     
  Fly   178 NCSRSSALGANLTGPNPAHGSPASEVVVGATEEV------DGAGEIHEGIANVLTNFEQY----- 231

Zfish   283 NSLEQANGEPVKI------------NQAIINSP------PSENNPPPAPKPKIWSLAETATTPDN 329
              ::..||:.||:            .|||.|:|      .|........|.|.:.:.:.|....:
  Fly   232 --VQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGS 294

Zfish   330 PRKSPLMNGTSAASATQTIITPHRL 354
            ...|....|:|:.|:..|.|.|:.|
  Fly   295 AVGSGGAGGSSSNSSPATSILPYSL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
irx3aNP_001307054.1 COG5576 <103..>191 CDD:227863 30/82 (37%)
Homeobox_KN 123..162 CDD:283551 19/38 (50%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.