DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myod1 and nau

DIOPT Version :9

Sequence 1:NP_571337.2 Gene:myod1 / 30513 ZFINID:ZDB-GENE-980526-561 Length:275 Species:Danio rerio
Sequence 2:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster


Alignment Length:232 Identity:96/232 - (41%)
Similarity:123/232 - (53%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


Zfish    46 DEHHHI-EDEHVRAP---SGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNDAFET 106
            ||:..: .:|||.||   |....:..||.|||||||:|:...||||||||||||||.|||:|||.
  Fly   119 DENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEI 183

Zfish   107 LKRCTSTNPNQRLPKVEILRNAISYIESLQALLRSQEDNYYPVLEHYSGDSDASSPRSNCSDGMM 171
            |||.||:||||||||||||||||.|||||:.||:....         :.|.|..:|         
  Fly   184 LKRRTSSNPNQRLPKVEILRNAIEYIESLE
DLLQESST---------TRDGDNLAP--------- 230

Zfish   172 DFMGPTCQTRRRNSYDSSYFNDTPN------------ADARNNKNSVVSSLDCLSSIVERISTET 224
            ...|.:||:...:||..:|..|..:            .|...|.|.  ||||||:.||:.|:..|
  Fly   231 SLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANG--SSLDCLNLIVQSINKST 293

Zfish   225 PACPVLSVPEGHEESPCSPHEGSVLSDTGTTAPSPTS 261
            .: |:        ::..:|......|...:.|.:|||
  Fly   294 TS-PI--------QNKATPSASDTQSPPSSGATAPTS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
myod1NP_571337.2 BASIC 1..89 CDD:128794 22/46 (48%)
HLH 85..136 CDD:278439 44/50 (88%)
Myf5 151..220 CDD:289036 21/80 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..275 6/28 (21%)
nauNP_476650.1 Basic 89..166 CDD:299793 22/46 (48%)
HLH 162..213 CDD:278439 44/50 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595014
Domainoid 1 1.000 89 1.000 Domainoid score I7839
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4470
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 1 1.000 - - otm26233
orthoMCL 1 0.900 - - OOG6_110195
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.