DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ret and Cad96Ca

DIOPT Version :9

Sequence 1:NP_858048.2 Gene:ret / 30512 ZFINID:ZDB-GENE-980526-307 Length:1106 Species:Danio rerio
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:304 Identity:129/304 - (42%)
Similarity:198/304 - (65%) Gaps:12/304 - (3%)


- Green bases have known domain annotations that are detailed below.


Zfish   708 KWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHSELRDLLSEFTLLK 772
            :|||||..|.....||||.||:|.:..|..:.|..|.||||||.|||:|:..:.:|||||..::|
  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526

Zfish   773 QVN-HPHVIKMYGACSQDGPLYLIVEYAKYGSLRNFLRESRKVGPSYMGNDANRNSSYLENPDER 836
            .:. |.:|:.:.|.|:...|.::|:||...|.|:.:||.||  ...:.||...:::         
  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSR--AERHYGNTHGKSN--------- 580

Zfish   837 ALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRS 901
            .||..||.||.:|:::||.||....::||||||||:|:.:....|::|||.:|||.....|.::|
  Fly   581 VLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKS 645

Zfish   902 KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLKTGYRMEKPE 966
            :|::|::|||.|||:|:|::.:||:||||:|:|||||||..|||||:...:...::.|||:||||
  Fly   646 EGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGYRLEKPE 710

Zfish   967 NCTDEMYNLMLRCWKQESDKRPTFSDISKELEKMMVKSRDYLDL 1010
            :|..|:||:|..||..:..:||.|::|.:.|:|::....||::|
  Fly   711 HCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIEL 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retNP_858048.2 CA 186..256 CDD:214520
PTKc_RET 715..1004 CDD:173631 121/289 (42%)
Pkinase_Tyr 716..997 CDD:285015 119/281 (42%)
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 119/281 (42%)
PTKc 474..742 CDD:270623 118/278 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.