DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ret and drpr

DIOPT Version :9

Sequence 1:NP_858048.2 Gene:ret / 30512 ZFINID:ZDB-GENE-980526-307 Length:1106 Species:Danio rerio
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:281 Identity:60/281 - (21%)
Similarity:84/281 - (29%) Gaps:111/281 - (39%)


- Green bases have known domain annotations that are detailed below.


Zfish   440 SCYWAVSLAQ-------NPN-------DNTGVLYVNDTKVLRR---------PECQ--ELEYVVI 479
            :|...:.|||       .||       .|..|:|........|         |.|.  .:::.|:
  Fly     8 ACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVV 72

Zfish   480 AQEQQNKLQAKTQLT-------VSFQGEADSLKTDEPRFPACAEKRQRG------DCEATRGLGA 531
               .:.|..||.::.       ::..||.         .|.|:|..|.|      .|:...|.|.
  Fly    73 ---NKTKTIAKNRIVRDCCDGYIASAGEC---------VPHCSEPCQHGRCISPEKCKCDHGYGG 125

Zfish   532 PTGRCQ------WRQGRDKGIS---KRYSTCSPNLG--TCPDGYCDAIESKNISICPQ-----DC 580
            |.  |.      | .||:..:.   ...:.|.|..|  .|..||..|   :...|||:     :|
  Fly   126 PA--CDINCPPGW-YGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGA---RCADICPEGFFGANC 184

Zfish   581 SSEAIIGGYERDLYGIKAGH--GTCYCFEG---------------------KCFCERD---EPED 619
            |.:.      |...|.|..|  |.|.|..|                     .|.|:.|   :||.
  Fly   185 SEKC------RCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPET 243

Zfish   620 DIC-------NDMCKTVIATG 633
            ..|       .|:|......|
  Fly   244 GACMCNPGWTGDVCANKCPVG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retNP_858048.2 CA 186..256 CDD:214520
PTKc_RET 715..1004 CDD:173631
Pkinase_Tyr 716..997 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877 11/67 (16%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.