DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment evx2 and eve

DIOPT Version :9

Sequence 1:NP_571307.2 Gene:evx2 / 30479 ZFINID:ZDB-GENE-980526-215 Length:418 Species:Danio rerio
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:308 Identity:119/308 - (38%)
Similarity:158/308 - (51%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish   148 SSSLSNLNGNSMGNSSSSSDQVRRYRTAFTREQIGRLEKEFYRENYVSRPRRCELAAALNLPETT 212
            ||..::||| |.|:...:...||||||||||:|:||||||||:||||||||||||||.|||||:|
  Fly    50 SSPDNSLNG-SRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPEST 113

Zfish   213 IKVWFQNRRMKDKRQRLAMSWPHPA---DPSFYTYMMTHAAATGSLPYPFHSHMPLHYYPHVGVT 274
            ||||||||||||||||:|::||:.|   ||:|...::..||.:..:|||          |:....
  Fly   114 IKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYP----------PYAPAA 168

Zfish   275 AAAAAAAASGAASSPFATSIRP-----LDTFRALSH--------PYSRPELLCSFRHPGLY---- 322
            ||||||||:.|.:...||.:.|     :.|.:...|        ||.:      :|:...:    
  Fly   169 AAAAAAAAAVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQ------YRYTPYHIPAR 227

Zfish   323 ---QSPAG--------LNSSAAASAAAAAAA------------AAAAVSAPSATGPCSCLSCHSS 364
               ..|||        :.|||..|:.:|.||            ....|..|....|...|...||
  Fly   228 PAPPHPAGPHMHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSS 292

Zfish   365 QAASALGSRSSSSD----FTCTATGQRSESGFLPYSAAVLSKTAVPSP 408
            ..:|.|......||    |..:...|.:.|  :|..|.:.:.:.:|:|
  Fly   293 PHSSTLSLSPVGSDHAKVFDRSPVAQSAPS--VPAPAPLTTTSPLPAP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
evx2NP_571307.2 Homeobox 173..225 CDD:278475 46/51 (90%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6034
eggNOG 1 0.900 - - E1_KOG0844
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002730
OrthoInspector 1 1.000 - - otm25513
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2896
SonicParanoid 1 1.000 - - X2525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.