powered by:
Protein Alignment ascl1b and HLH4C
DIOPT Version :9
Sequence 1: | NP_571306.1 |
Gene: | ascl1b / 30478 |
ZFINID: | ZDB-GENE-980526-174 |
Length: | 195 |
Species: | Danio rerio |
Sequence 2: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 25/65 - (38%) |
Similarity: | 35/65 - (53%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Zfish 74 RERNRVKQVNMGFQTLRQHVPNGAANKKMSKVETLRSAVEYIRALQQLL----DEHDAVSAVLQC 134
|||.||:..|:.|..||:.:|....:||:||:|.|:.|:.||..|..:| |...|.|....|
Fly 116 RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGASSFATSC 180
Zfish 135 134
Fly 181 180
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.