DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ascl1b and HLH4C

DIOPT Version :9

Sequence 1:NP_571306.1 Gene:ascl1b / 30478 ZFINID:ZDB-GENE-980526-174 Length:195 Species:Danio rerio
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:65 Identity:25/65 - (38%)
Similarity:35/65 - (53%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


Zfish    74 RERNRVKQVNMGFQTLRQHVPNGAANKKMSKVETLRSAVEYIRALQQLL----DEHDAVSAVLQC 134
            |||.||:..|:.|..||:.:|....:||:||:|.|:.|:.||..|..:|    |...|.|....|
  Fly   116 RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGASSFATSC 180

Zfish   135  134
              Fly   181  180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ascl1bNP_571306.1 HLH 79..124 CDD:197674 17/48 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 20/48 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.