Sequence 1: | NP_571301.2 | Gene: | rx2 / 30473 | ZFINID: | ZDB-GENE-990415-237 | Length: | 327 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
Alignment Length: | 304 | Identity: | 128/304 - (42%) |
---|---|---|---|
Similarity: | 159/304 - (52%) | Gaps: | 76/304 - (25%) |
- Green bases have known domain annotations that are detailed below.
Zfish 45 FSKDQDPLLE----PIGTHKVDEDQLEEQEKQVNSDPYSHLQIPDQTQQQQSVYHDTGLFSTDKC 105
Zfish 106 DADLGDP-----------RSNVESDS-------RSPDI--------------------PDEDQPK 132
Zfish 133 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMD 197
Zfish 198 TGTMKLHDSPIRSFNRPPMAPNVGPMSNSLPLDPWLSSPLSSATPMHSIPGFMGPGQSLQPTYTA 262
Zfish 263 HPGFLNTSPG--MMQNMQPM--------PPPPY-------QCQP 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rx2 | NP_571301.2 | Octapeptide motif | 37..44 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..73 | 7/28 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 100..139 | 18/76 (24%) | |||
Homeobox | 139..191 | CDD:278475 | 51/51 (100%) | ||
OAR | 302..316 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 304..317 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 310..314 | ||||
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 51/51 (100%) |
OAR | 876..892 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 123 | 1.000 | Domainoid score | I5546 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 1 | 1.000 | - | - | otm25263 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106944 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2565 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.850 |