DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rx1 and Rx

DIOPT Version :9

Sequence 1:NP_571300.2 Gene:rx1 / 30472 ZFINID:ZDB-GENE-990415-236 Length:330 Species:Danio rerio
Sequence 2:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster


Alignment Length:305 Identity:116/305 - (38%)
Similarity:139/305 - (45%) Gaps:93/305 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish    22 HDMVKAGGAVVGTRVHSIDVILGFNKDQDSLLNPGANAVAHKVGGESLGEPGKLDQRVQPYGHLP 86
            ||...:|........:|.|.....|.|.|||:| |:.|.:..:...:..|.|:            
  Fly   488 HDFRNSGNGNPNGNSNSGDHGERLNADSDSLVN-GSCASSEDLNQTNSSEQGE------------ 539

Zfish    87 PLRDGSEQPTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSADGEQPKKKHRRNRTTFTTYQLHE 151
            .:..||:.                               :..|....||||||||||||||||||
  Fly   540 KITSGSDD-------------------------------EGQDDNCAKKKHRRNRTTFTTYQLHE 573

Zfish   152 LERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDASTMKLHDSPMLSFNRP 216
            ||||||||||||||||||||||||||||||||||||||||||||||.::..:.|.....|...  
  Fly   574 LERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHR-- 636

Zfish   217 SMHPTVGPMNNSLPLDPWLPSPLSSATPVHSIPGFMGPTQGLQTGYPGHSFLSPPQPMAQSM--- 278
                 :|...:.||:||||..||.||     :|||:...   ||.||  |:|:||..:|...   
  Fly   637 -----LGCGASGLPVDPWLSPPLLSA-----LPGFLSHP---QTVYP--SYLTPPLSLAPGNLTM 686

Zfish   279 --------------------------QPMAPPPYQCPPPFTDKYP 297
                                      ||..|||   |||....:|
  Fly   687 SSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPP---PPPHGVPHP 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rx1NP_571300.2 Octapeptide motif 37..44 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..104 4/37 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 8/23 (35%)
Homeobox 141..193 CDD:278475 51/51 (100%)
OAR 302..318 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Nuclear localization signal. /evidence=ECO:0000255 312..316
RxNP_726006.3 Homeobox 563..615 CDD:278475 51/51 (100%)
OAR 876..892 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5546
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm25263
orthoMCL 1 0.900 - - OOG6_106944
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.