DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkia and qkr58E-3

DIOPT Version :9

Sequence 1:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio
Sequence 2:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster


Alignment Length:345 Identity:94/345 - (27%)
Similarity:151/345 - (43%) Gaps:91/345 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish     7 EVKERPRPSPD-----------YLMQLLNEKKLMTSLPNLCGIFTHLERLLDEEINRV------- 53
            |..|:..|:.|           :|..|..|::.:::...||.:      |:||.::||       
  Fly     6 EFTEKQPPTHDHQPRLNEVAQKFLADLDEERQRLSADFPLCAL------LIDEAVDRVYCTGRIP 64

Zfish    54 RKDMYNDSVNGLVDKHPLELPEPVGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAET 118
            .|:.|.|    :..:.|::          :.:|:|||||:||.:||.|:||||:|.:.::|:.||
  Fly    65 GKEFYAD----VYKQKPMK----------ITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEET 115

Zfish   119 GCKIMVRGRSSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKKLLV 181
            .|||.::||||:||:.||||.|  |.|.:.||.:||.:.::...|......::..|:.|::|.|:
  Fly   116 QCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLI 180

Zfish   182 PAAEGEDNLKKMQLMELAILNGTYRDTNIKAPTL-----AFSLAAAAAAAQGPRLI------AAP 235
            |  :..|.:...||.||..:: .....||..|.|     .|.......:...|:.|      |..
  Fly   181 P--DKNDEVSHEQLRELMEMD-PESAKNIHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAEN 242

Zfish   236 PGQV-------------LPPATLRPPTPAGTPIMNIIRPTQMATVLPNGTPTLVPPTPDAGIIYT 287
            |.:|             :||.  ||||.     ....:|          .|:::|....|     
  Fly   243 PPEVDDVEEVAYEYEHRMPPK--RPPTG-----YEYSKP----------RPSIIPTNAAA----- 285

Zfish   288 TPYDYPYALAPTSLLEYPIE 307
              |..||......:.|.||:
  Fly   286 --YKRPYPTDMKRMREPPIK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152 15/75 (20%)
SF1_like-KH 84..206 CDD:239088 50/123 (41%)
Quaking_NLS 356..383 CDD:293159
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 50/121 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.