DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atp1b3a and CG33310

DIOPT Version :9

Sequence 1:NP_571296.2 Gene:atp1b3a / 30468 ZFINID:ZDB-GENE-990415-167 Length:278 Species:Danio rerio
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:319 Identity:67/319 - (21%)
Similarity:116/319 - (36%) Gaps:101/319 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    16 SSWKDAIYNPRTGELFGRTARNWGLILLFYLVFYGFLAAMFVFTL-WVMLQTLNDDTPKY--RDR 77
            :.|:...:|...|:...|...:|...|:|.:::..|   :.:|:: |  ...:.||..:.  ..:
  Fly   582 TEWRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILF---VIIFSMAW--FDFIKDDASRKVPMIK 641

Zfish    78 VASPGLVIRP-----NSLNIEFNRSDPLEYGQYVQHLESFLHQYND-SEQAKNDLCMAGQYSEQD 136
            :|.|.:...|     |...:.|:..:..|..:....:.:.|.:|.| ....:...|.|.:     
  Fly   642 MAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANE----- 701

Zfish   137 GESLKKVCQFKRSLLYSCSGMEDTTFGYAKGQPCVIVKMNRIIGLKPSGDPYIN----------- 190
                                    .|||..|:|||.:|:|||||.|.  :||||           
  Fly   702 ------------------------KFGYPSGEPCVFLKVNRIIGFKT--EPYINSDELVKAKIDE 740

Zfish   191 --------------------------CTSKSVKPLQMQYFPH----------EGTIDRMYFPYYG 219
                                      |.|...|.:.:::.|.          |..|:  |....|
  Fly   741 VEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIE--YIANEG 803

Zfish   220 KKTHKG--YVQPLVAVKLLLKKEDYNSELIVECKVEGSNLKNNDERDKFLGRVTFRVLV 276
            ||:..|  .|..:||:|  :|....|..:.:.||:...|:.:   |.:..|:|:|.||:
  Fly   804 KKSFFGPNDVNRIVALK--IKNLKANERVHINCKMWAQNIHH---RKEGYGQVSFFVLL 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atp1b3aNP_571296.2 Na_K-ATPase 13..271 CDD:278704 63/312 (20%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.