DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oasl and Ubi-p5E

DIOPT Version :9

Sequence 1:NP_001009681.1 Gene:Oasl / 304545 RGDID:1308586 Length:512 Species:Rattus norvegicus
Sequence 2:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:158 Identity:44/158 - (27%)
Similarity:79/158 - (50%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat   351 IQVTVQQWGHPDLILWVNPYEPIKKLKEKIRLSRGY-SGLQRLSFQEPGGQRQLIRSQCSLAYYG 414
            :|:.|:......:.|.|.|.:.|:.:|.||:...|. ...|||.|   .|::  :....:|:.|.
  Fly   381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF---AGKQ--LEDGRTLSDYN 440

  Rat   415 IFCDTQICLLDTISPEIQVFVKNPDGGSHAYAIHPLDFVLSLKQQIEDRQGLQSQEQQLEFQGRV 479
            |..::.:.|:..:...:|:|||...|.:....:.|.|.:.::|.:|:|::|:...:|:|.|.|:.
  Fly   441 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQ 505

  Rat   480 LEDWFDFKSYGIQDSITIILSRKREGKA 507
            |||......|.||...|:.|..:..|.|
  Fly   506 LEDGRTLSDYNIQKESTLHLVLRLRGGA 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OaslNP_001009681.1 NT_2-5OAS_ClassI-CCAase 29..209 CDD:143390
OAS1_C 167..347 CDD:287404
UBQ 351..430 CDD:294102 19/79 (24%)
UBQ 431..499 CDD:214563 22/67 (33%)
ubiquitin 436..502 CDD:278661 20/65 (31%)
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398 19/79 (24%)
UBQ 381..452 CDD:214563 19/75 (25%)
Ubiquitin 457..532 CDD:176398 23/74 (31%)
UBQ 457..528 CDD:214563 23/70 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.