DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsig10 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001258265.1 Gene:Vsig10 / 304529 RGDID:1565800 Length:564 Species:Rattus norvegicus
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:409 Identity:86/409 - (21%)
Similarity:142/409 - (34%) Gaps:134/409 - (32%)


- Green bases have known domain annotations that are detailed below.


  Rat    33 LVYQSN--SPVL---PGIHPDLPFTDSEAVAIGEVHENVTLRC--GSLSGSRGLVTWYRNDSEPA 90
            |:|.:|  :.|:   |.....:|   :..||:|   .:..|.|  ..|.|.:  |.|...|.:  
  Fly    29 LIYMTNLVTHVMMDEPRFAQPIP---NVTVAVG---RDANLPCVVEHLGGYK--VAWIHIDRQ-- 83

  Rat    91 FLVSSNSSLPPAAPRFSL---EDAGALRIEALRLEDDGNYTCREVLNETHWFPVQLRVTSGPAHI 152
            .:::.:..:....||:|:   ::...|.:.....:|.|.|.|:...|........|:|...|..:
  Fly    84 MILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNIL 148

  Rat   153 DVNISATGTLPNGTLYAARGSQ-VDFSCCSAAQPPPEVEWWIQTHSSVSESLGKNL---SANSFT 213
            |:..:.:..       |.|.:| ::.:|.:...|.|::.|..:....::....|.:   .|:...
  Fly   149 DIESTPSSV-------AVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLP 206

  Rat   214 LMLMSKNLQGNYTCSATNVLSRRQRKVTTELLVYWPPPSAPQ---CSAGLSPESANLELTCNWDG 275
            |..:|:|..|.|.|.|||.:                |||..:   .....||             
  Fly   207 LTKVSRNEMGAYLCIATNGV----------------PPSVSKRIILDVEFSP------------- 242

  Rat   276 GYPDPTFLWTEEPGGVVVGNSKLQTLSPSQLSEGKKFKCVGSHILGPESGASCVVQISSPLLASR 340
                  .:|.                 |:||             :|..||.              
  Fly   243 ------MIWV-----------------PNQL-------------VGAPSGT-------------- 257

  Rat   341 PMKTCLVGGDVTLTCQVEGANPPARIQWLRNLTQPETAIQPSSRYVITQQGQSS-----SLTIHN 400
                     |||:.|..| |:|.|.|.|:.|    ...:.||.:|. |...::|     .|||.|
  Fly   258 ---------DVTIDCHTE-AHPKAIIYWVYN----SVMVLPSKKYK-TDYTENSYRAHMKLTIRN 307

  Rat   401 CSQDQDGGFYFCRAENPVG 419
            . |..|.|.|.|.::|.:|
  Fly   308 L-QYGDFGNYRCISKNSLG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsig10NP_001258265.1 Ig 60..146 CDD:299845 18/90 (20%)
IG_like 60..145 CDD:214653 18/89 (20%)
IG_like 165..246 CDD:214653 18/84 (21%)
Ig 175..241 CDD:143165 15/68 (22%)
Ig_3 255..318 CDD:290638 6/65 (9%)
IG_like 347..429 CDD:214653 27/78 (35%)
Ig 351..426 CDD:143165 26/74 (35%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 22/101 (22%)
Ig 145..238 CDD:416386 23/115 (20%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 0/11 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 35/163 (21%)
Ig strand A' 250..253 CDD:409353 1/15 (7%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/4 (25%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.