DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment serpinh1b and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:384 Identity:110/384 - (28%)
Similarity:187/384 - (48%) Gaps:37/384 - (9%)


- Green bases have known domain annotations that are detailed below.


Zfish    28 TSMADTSANLAFNLYHNVAKEKGLENILISPVVVASSLGMVAMGSKSSTASQVKSVLKADALKDE 92
            ||:|..::.   .:|..::|....:|:::|||.:.:.|.||.||::.|||.:::|.|...:...|
  Fly    11 TSVACQTSK---EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKE 72

Zfish    93 HLHTGLSELLTEVSDPQTRNVTWKISNRLYGPSSVSFAEDFVKNSKKHYNYEHSKINFRDKRSAI 157
            .:......||.::.. |......|::||:|.....|..:::....::.:..|...|:..:...|.
  Fly    73 AVAARYGALLNDLQG-QEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAA 136

Zfish   158 NSINEWAAKTTDGKLP------EITKDVKNTDGAMIVNAMFFKPHWDEKFHHKMVDNRGFLVTRS 216
            ..||:|....|.||:.      .:|.|||    |::|||::||..|:.||.........|.||.:
  Fly   137 ERINQWVLDQTSGKIKGMIDPGSMTSDVK----ALLVNAIYFKGQWESKFDPAKTRASTFQVTAN 197

Zfish   217 HTVSVPMMHRTGIY--GFYEDTENRFLIVSMPLAHKKSSMIFIMPYHVEPLDRLENLLTRQQLDT 279
            .:|.|.||.:.|.:  .::.|.:.:  ::.:|..:...||...:|..||.|..||     :::..
  Fly   198 KSVPVQMMAQMGTFRANYFRDLDAQ--VIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVG 255

Zfish   280 WISKLEERAVAISLPKVSMEVSHDLQKHLGELGLTEA-VDKSKADLSNI----SGKKDLYLSNVF 339
            :...|..:.|.:.|||..:|...:|::.|.:||:.|. .|||  |||.:    ||.|   :|.|.
  Fly   256 FARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKS--DLSGLFADKSGGK---VSQVS 315

Zfish   340 HASSLEWDTEGNPF--DPSIFGSEKMRNPKLFYADHPFIFLVKDNKTNSILFIGRLVRP 396
            |.:.||.:.||...  ..|:..:.:........|||||.|:::|  .|:|.|.||:|.|
  Fly   316 HKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 107/379 (28%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/374 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.