DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment serpinh1b and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:439 Identity:93/439 - (21%)
Similarity:178/439 - (40%) Gaps:59/439 - (13%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MWVSSLIALCLL-AVAVSGEDK-KLS--THATSMADTSANLAFNLYHNVAKEKGLENILISPVVV 61
            |...||:.|.|| .|.::..|| :||  ...:.:.....:.:..|...:.:.....|:..||...
  Fly     1 MHTFSLVLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFST 65

Zfish    62 ASSLGMVAMGSKSSTASQVKSVLKAD-ALKDEHLHTGLSELLTEVSDPQTRNVTWKIS------- 118
            .::|.:....|...|..::...|... ||..:.:.  :|..|.:..|    ...|:.|       
  Fly    66 YNALLLAYFSSSEQTERELAQALNLGWALNKQQVL--VSYTLAQRQD----EFRWRQSPMELSSA 124

Zfish   119 NRLYGPSSVSFAEDF---VKNSKKHYNYEHSKINFRDKRSAINSINEWAAKTTDGKLPEITKDVK 180
            ||::...:::.:..|   :..:.|..::::      |..:.:..||:|.|..|..::.::....:
  Fly   125 NRIFVDRTINVSNKFNTLLYGATKELDFKN------DPETGLKEINDWIADKTHNQIRDMLSSEE 183

Zfish   181 NTDGAMIV--NAMFFKPHWDEKFHHKMVDNRGFLVTRSHTVSVPMMHRTGIY------------- 230
            .|...|:|  ||.:.|..|..:|..:....:.|.:.......|.|||:||.:             
  Fly   184 ITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQII 248

Zfish   231 -----GFYEDTENRFLIVSMPLAHKKSSMIFIMPYHVE-PLDRLENLLTRQQLDTWISKLEERAV 289
                 ..|:..|..   :|.|.:....|||.|:|...: .|:|:.:.|....:..|..:...:.:
  Fly   249 KLPYRTIYKSKETH---ISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI 310

Zfish   290 AISLPKVSMEVSHDLQKHLGELGLTEAVDKSK--ADLSNISGKKDLYLSNVFHASSLEWDTEGNP 352
            .:||||...|...:|...|..:|:.....::.  .||:  :....|.:.:..|.:.::.|..|:.
  Fly   311 ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGST 373

Zfish   353 FDPS----IFGSEKMRNPKLFYADHPFIFLVKDNKTNSILFIGRLVRPK 397
            ...:    :..|.:..:|..|..:|||:||:.|.|.::|||.|....|:
  Fly   374 AAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 81/402 (20%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 81/397 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.