DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ednrba and CCHa1-R

DIOPT Version :9

Sequence 1:NP_571272.1 Gene:ednrba / 30442 ZFINID:ZDB-GENE-980526-16 Length:426 Species:Danio rerio
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:337 Identity:104/337 - (30%)
Similarity:168/337 - (49%) Gaps:44/337 - (13%)


- Green bases have known domain annotations that are detailed below.


Zfish    63 RRPKVLPPMCTDPTEIRDTFKYINTVVSCLVFVVGIIGNSTLLRIIYKNKCMRNGPNILIASLAL 127
            |||:.                ||..::..|:||||::||.||:.:....:.|||.||..|.||||
  Fly    77 RRPET----------------YIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLAL 125

Zfish   128 GDLLHIMIDIPINVYKLLAKDWPFGVGLCKLVPFIQKTSVGITILSLCALSIDRFRAVSSWNR-- 190
            .|||.|:..:|:.......:.||:|..||.|..|::..|:|:::.:|.|||.||:.|:....|  
  Fly   126 ADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKF 190

Zfish   191 -IKGIG--VPKWTAIEIILIWVLSIILAVPEAIAFDMITMDYKGEQLRICLLHPKQ-RIKFMQFY 251
             ..|.|  ..:.|....:.||:|:|:..:|..|..::..:....:.:.||..:|:: .|.:    
  Fly   191 HAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINY---- 251

Zfish   252 KKAKDWWLFSF--YFCMPLTCTAIFYTLMTCEMLRKKN---GVQIALSDHIKQRREVAKTVFCLV 311
              ||...|..|  |:.:||...|:||.|:...::...:   .:|.|:. .::.||:||.||...|
  Fly   252 --AKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVR-QVRARRKVAVTVLAFV 313

Zfish   312 LVFALCWLPLHLSRI---LQRTIYDERDPNRCELLSFFLVLDYIGINMASVNSCINPIALYMVSK 373
            ::|.:|:||.|:..:   ...|..|:.:       :|:.||..:...|:..|||.||:|||.||.
  Fly   314 VIFGICFLPYHVFFLWFYFWPTAQDDYN-------AFWHVLRIVAYCMSFANSCANPVALYFVSG 371

Zfish   374 RFKSCFRSCLCC 385
            .|:..|...|.|
  Fly   372 AFRKHFNRYLFC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ednrbaNP_571272.1 7tm_4 95..>215 CDD:304433 46/124 (37%)
7tm_1 100..366 CDD:278431 84/279 (30%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 40/99 (40%)
7tm_1 98..364 CDD:278431 84/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.