DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pax2a and al

DIOPT Version :9

Sequence 1:XP_021336168.1 Gene:pax2a / 30425 ZFINID:ZDB-GENE-990415-8 Length:519 Species:Danio rerio
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:386 Identity:94/386 - (24%)
Similarity:127/386 - (32%) Gaps:144/386 - (37%)


- Green bases have known domain annotations that are detailed below.


Zfish   158 HPSS-----DGTGTPLSTAGHTIGDLESTPYTLTYSCALSVPSTASPPVSSASNDPVGSYSINGI 217
            ||.:     ...|:..::||..:        |::.|.:...||.|| ..|..:|.||        
  Fly    20 HPDAVVLVDRAPGSSAASAGAAL--------TVSMSVSGGAPSGAS-GASGGTNSPV-------- 67

Zfish   218 LGIPRSNGEKRKRDDVLWSGNHLDGRKIGYYGSDGSGPNSDSQGSVESLRKHLR--ADAFTQQQL 280
                                            |||   |||.:....:.::..|  ...||..||
  Fly    68 --------------------------------SDG---NSDCEADEYAPKRKQRRYRTTFTSFQL 97

Zfish   281 EALDRVFERPSYPDVFPTSEHIKPEQANEYSLPALNPGLDEVKPSLSTSVSSDLGSSVSQSYPVV 345
            |.|::.|.|..||||| |.|.:           |:..||.|.:..                   |
  Fly    98 EELEKAFSRTHYPDVF-TREEL-----------AMKIGLTEARIQ-------------------V 131

Zfish   346 TESHSSSMCVKQE---PHEASLAPFTPSSLA----VSGLAELLPLQP--SVSVDASTPCYGAYAH 401
            ...:..:...|||   |......|:.|...|    |.|.|  ||..|  .:......|   ..|.
  Fly   132 WFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAA--LPPNPFTHLGFQLRKP---FDAQ 191

Zfish   402 HAPSYCQYTSQHIIAGREMASTTLPGY-------PPHVPPTGQ-GSY-PTST----LAGM--VPG 451
            ||.:...:...|:.|...:.|    ||       |||:.|.|. |.| |:|:    ||.|  || 
  Fly   192 HAANLAAFRYPHLSAAPMIPS----GYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVP- 251

Zfish   452 SDFSGNPYSHPQYTTYNEAWRFSNPALLMPHPG--APGLPLLPLPMTATSYHRSPVKLQDH 510
               .|.|...|             ||||:..|.  :|...|...|.:..|.|.|  :.|.|
  Fly   252 ---RGTPLGKP-------------PALLVGSPDLHSPNHMLASPPTSPASGHAS--QHQQH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pax2aXP_021336168.1 PAX 19..150 CDD:128645
Pax2_C 391..500 CDD:315141 34/125 (27%)
alNP_722629.1 Homeobox 89..141 CDD:278475 20/82 (24%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.