DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc3a and Scr

DIOPT Version :9

Sequence 1:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:173 Identity:67/173 - (38%)
Similarity:85/173 - (49%) Gaps:48/173 - (27%)


- Green bases have known domain annotations that are detailed below.


Zfish    64 ESSSENDKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALEREKACELSTSCLSTMKYPWMRETH 128
            :|.||:|.||           ...|..:.||...:|...                  ||||:..|
  Fly   277 DSDSESDSGN-----------EAGSSQNSGNGKKNPPQI------------------YPWMKRVH 312

Zfish   129 APTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAE 193
            ..|  |::||         |||       :||.|.::|..|.|||||||||:.||.|.||:|:|.
  Fly   313 LGT--STVNA---------NGE-------TKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAH 359

Zfish   194 LLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKSSYTYLGTENQP 236
            .|.||:|||||||||||||:||:||..|.....| ::|....|
  Fly   360 ALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY-HMGPYGHP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 55/114 (48%)
Homeobox 162..214 CDD:306543 35/51 (69%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.