DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb8b and Antp

DIOPT Version :9

Sequence 1:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:199 Identity:79/199 - (39%)
Similarity:94/199 - (47%) Gaps:61/199 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish    24 YDCPSYTPDLGGRPSVLYGHNTGSAFQHAAQFPDFYHHGTSSFPHASYQQTPCAVAYPGDATGNI 88
            |...|..|.:|..|         ....|..|.|...|.|                 :||..|   
  Fly   231 YQQQSGVPPVGAPP---------QGMMHQGQGPPQMHQG-----------------HPGQHT--- 266

Zfish    89 LGQDGLQKQSFFGAPDSDFTQFGDCNLKVSGIRDDLESAEPCTAQLFPWMRPQ---ATGRRRGRQ 150
                          |.|.     :.|.:.||:          .:.|:||||.|   ...|:||||
  Fly   267 --------------PPSQ-----NPNSQSSGM----------PSPLYPWMRSQFGKCQERKRGRQ 302

Zfish   151 TYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFPSSKAE 215
            ||:|||||||||||.||.||||:||||::|||.|||||:||||||||||||||:.....|.|..|
  Fly   303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367

Zfish   216 QEEI 219
            .:||
  Fly   368 GDEI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 3/4 (75%)
Homeobox 149..201 CDD:278475 43/51 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 8/19 (42%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/132 (23%)
Homeobox 301..354 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.