powered by:
Protein Alignment hoxb8b and unpg
DIOPT Version :9
Sequence 1: | NP_571256.1 |
Gene: | hoxb8b / 30420 |
ZFINID: | ZDB-GENE-980526-291 |
Length: | 247 |
Species: | Danio rerio |
Sequence 2: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Alignment Length: | 57 |
Identity: | 29/57 - (50%) |
Similarity: | 39/57 - (68%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Zfish 146 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKK 202
||.|..::..|.||||:||....||:...|.:::.:|.|:|.||||||||||.|||:
Fly 320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.