DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twist2 and twi

DIOPT Version :9

Sequence 1:NP_001005956.1 Gene:twist2 / 30395 ZFINID:ZDB-GENE-980526-235 Length:163 Species:Danio rerio
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:213 Identity:80/213 - (37%)
Similarity:102/213 - (47%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish    11 PVDSLVTSE-EELDRQQKRFGRKRRQGRKS------------SEDSSSPSSVN------------ 50
            |.:||..|. ...||....:.|.......|            ::|.|:.|.::            
  Fly   279 PANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKP 343

Zfish    51 KRNKKPSPSSTQSFEELQNQRVLANVRERQRTQSLNEAFASLRKIIPTLPSDKLSKIQTLKLASR 115
            :|..|..||.|:..:|..||||:|||||||||||||:||.||::|||||||||||||||||||:|
  Fly   344 RRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATR 408

Zfish   116 YIDFLCQVLQSDEMD-----------------------------------NKMSSCSYVAHERLS 145
            ||||||::|.|.::.                                   .|.:....:..|:||
  Fly   409 YIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLS 473

Zfish   146 YAFSVWRMEGAWSMSASH 163
            |.|.||||||    .|.|
  Fly   474 YLFGVWRMEG----DAQH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twist2NP_001005956.1 HLH 70..120 CDD:278439 43/49 (88%)
twiNP_001033967.1 HLH 363..413 CDD:278439 43/49 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583751
Domainoid 1 1.000 91 1.000 Domainoid score I7661
eggNOG 1 0.900 - - E1_KOG4447
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm25873
orthoMCL 1 0.900 - - OOG6_107717
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.