DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp19a1a and Cyp4p3

DIOPT Version :9

Sequence 1:NP_571229.3 Gene:cyp19a1a / 30390 ZFINID:ZDB-GENE-990415-43 Length:517 Species:Danio rerio
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster


Alignment Length:321 Identity:83/321 - (25%)
Similarity:146/321 - (45%) Gaps:49/321 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish   183 ICTTSTNSHLDDLSQLTDAQGQLDILNLLRCIVVDVSNRLFLGVPLNEHDLLQKIHKYFDTWQTV 247
            ||.|:....||::::..|...: :...:..|.:..:||.|.                :.||...:
  Fly   193 ICETAMGVKLDEMAEKGDRYRE-NFRQIEECFIRRMSNPLL----------------WSDTLFKM 240

Zfish   248 LIKPDVYFRLDWLHK------KHKRDAQELQDAITALIEQKKVQLAHAEKLDHLDFTAE------ 300
            ..:.|....||.:|.      ..:||  :|.|.|.:   :...|.|..|.     ||::      
  Fly   241 FAEKDYASALDVVHGFSSEIIAKRRD--QLNDEIDS---RGNTQTAEDEL-----FTSKKRFAML 295

Zfish   301 --LIFAQSHGELSAENVRQCVLEMVIAAPDTLSISLFFMLLLLKQNPDVELKILQEMDSVLAGQ- 362
              ||.|:..|.:....:.:.|..::....||.||.|.|.|:.:...|:.:.|..||:.:.:..: 
  Fly   296 DTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDEL 360

Zfish   363 -SLQHSHLSKLQILESFINESLRFHPVVDFTMRRAL-DDDVIEGYNVKKGTNIILNVGRMHRS-E 424
             .|....|:||:.||.||.|::|..|.|....|... :.::..|..:.||:.|.::|..:||: |
  Fly   361 NILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPE 425

Zfish   425 FFSKPNQFSLDNF----HKNVPSRFFQPFGSGPRSCVGKHIAMVMMKSILVALLSRFSVCP 481
            ::..|.:|..:.|    .:|..:..:.||.:|.|:|:|:..||..||:::||||.:|.:.|
  Fly   426 YWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp19a1aNP_571229.3 None
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 83/321 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.