DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn2 and Fili

DIOPT Version :9

Sequence 1:NP_001100555.1 Gene:Cpn2 / 303861 RGDID:1305170 Length:565 Species:Rattus norvegicus
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:534 Identity:135/534 - (25%)
Similarity:209/534 - (39%) Gaps:121/534 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 WLCWA----SLLLLVRVTQP------CPVGCDCF----DRKIFCSDEQLAAIPLDIPSH------ 73
            |||.|    .||||..|..|      ||..|.|.    :.:..|.|..|..:|:.:...      
  Fly    16 WLCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINL 80

  Rat    74 -VTDIVFVETS----------------FTTVGTRAFSGSPNLTKVVFLNTRVHHLEPDAFGGLPR 121
             |..|..:|.|                ..|:|::.|.....|..:......|..|...||.||..
  Fly    81 TVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145

  Rat   122 LEDLEVTGSPFSNLSANIFSNLSSLGKLTLDFNRLAALPEDLFHHMDTLESLQLQGNQLQTLPGR 186
            |..|:::.:....:.....|:|:||.:|.|..|.:.:|.::.|..|:|||.|..:.|:|..:|..
  Fly   146 LLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPAS 210

  Rat   187 LFQSLRYLRTLNLAQNLLTQLPKGMFQSLSSLQILKLSDNMFARLPEGVLSNLGSLQELFLDSNA 251
            ....|..|::|:::.||:..:....|:.|.  ::|.||                      :..|.
  Fly   211 NLWHLHALKSLDMSLNLVEFVRNDSFEGLK--ELLALS----------------------VQGNV 251

  Rat   252 ITELSPHLFSHLLSLEKLWLQHNAISHLPVSAFSSLRNLTFLNLKDNALRTLPAGLFTHNPGLLH 316
            ::||....|..|:||:.|.|..|.::.:|....|.|.|||:|||..|....|||..|.:...|..
  Fly   252 MSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRE 316

  Rat   317 LSLS-YNQLETVPEGSFANLRKLASLTLSHN-AITHLPENVFRNLEQLVKLSLDSNNLTVLHPTL 379
            |.|| .:.|:.:...:|.:...|.:|.|::| .::.:|..:|:....::::.:.||:|..|:...
  Fly   317 LHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQ 381

  Rat   380 F--HNLSKLQLLDLSRNQLTMLPGGIFDTNYDLFNLALLGNPWQCDCRLSYLTSWLRLYNDRIFN 442
            |  ..|.||.|.|                           ||.||:|.|.:|  | ||...   |
  Fly   382 FPVDQLQKLYLGD---------------------------NPLQCNCSLLWL--W-RLVTG---N 413

  Rat   443 THTFCAGPAYLKGQLVPNLKQEQLVCPGNPGQLGLDDREPAGSWDLAVEGRAAHRQCIYGNPEGT 507
            ......|..:..|..|..|.:|            .||.|      ||.|..|     :....:|.
  Fly   414 FEGVDPGMEHAAGGAVAALAKE------------ADDEE------LADEATA-----VASTDDGV 455

  Rat   508 VLLACEEAQCRWLN 521
            ..||...|:...:|
  Fly   456 AALAAYIAEQHIVN 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpn2NP_001100555.1 LRRNT 44..75 CDD:214470 9/47 (19%)
leucine-rich repeat 77..97 CDD:275380 6/35 (17%)
LRR_8 96..156 CDD:290566 16/59 (27%)
leucine-rich repeat 122..145 CDD:275380 4/22 (18%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR_8 169..226 CDD:290566 17/56 (30%)
leucine-rich repeat 170..193 CDD:275380 7/22 (32%)
LRR_RI 172..418 CDD:238064 60/249 (24%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..241 CDD:275380 3/22 (14%)
LRR_8 241..300 CDD:290566 20/58 (34%)
leucine-rich repeat 242..265 CDD:275380 5/22 (23%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
LRR_8 288..348 CDD:290566 21/61 (34%)
leucine-rich repeat 290..313 CDD:275380 10/22 (45%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
LRR_8 336..396 CDD:290566 16/62 (26%)
leucine-rich repeat 338..361 CDD:275380 6/23 (26%)
leucine-rich repeat 362..383 CDD:275380 5/22 (23%)
leucine-rich repeat 386..405 CDD:275380 3/18 (17%)
LRRCT 418..459 CDD:214507 13/40 (33%)
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 4/21 (19%)
leucine-rich repeat 98..121 CDD:275380 3/22 (14%)
LRR_8 120..180 CDD:404697 16/59 (27%)
leucine-rich repeat 122..145 CDD:275380 7/22 (32%)
leucine-rich repeat 146..169 CDD:275380 4/22 (18%)
LRR <161..>354 CDD:227223 61/216 (28%)
leucine-rich repeat 170..193 CDD:275380 7/22 (32%)
leucine-rich repeat 194..217 CDD:275380 7/22 (32%)
leucine-rich repeat 218..265 CDD:275380 14/70 (20%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 10/22 (45%)
leucine-rich repeat 314..338 CDD:275380 6/23 (26%)
LRR_8 337..397 CDD:404697 17/86 (20%)
leucine-rich repeat 339..360 CDD:275380 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D187891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.