DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp26a1 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_571221.2 Gene:cyp26a1 / 30381 ZFINID:ZDB-GENE-990415-44 Length:492 Species:Danio rerio
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:498 Identity:105/498 - (21%)
Similarity:189/498 - (37%) Gaps:126/498 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish    46 PGTMGLPFIGETLQLI-------LQRRKFLRMKRQKYGCIYKTHLFGNPTVRVMGADNVRQILLG 103
            |....||.:|....::       :.:|.:.:.|.|  |.|...::|...|..:...|.::|:::.
  Fly    32 PHETPLPIVGNMRGIVKKYHFRDINQRIYKKFKGQ--GPIAGMYMFFKRTALITDLDFIKQVMIK 94

Zfish   104 EHK----------------------LVSVQWPASVRTILGSDTLSNVHGVQHKNKKKAIMRAFSR 146
            :..                      |...:|.|....:....|...:     |...|.|:....|
  Fly    95 DFSYFQDRGAFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKI-----KQMSKVIVDVGLR 154

Zfish   147 --DALEHYIPVIQQEVKSAIQEWLQKDSCVLVYPEMKKLMFRIAMRIL----LGFEPEQIKTDEQ 205
              ||::           .|::|...::..|    |:|.|..|....::    .|.|...::....
  Fly   155 LGDAMD-----------KAVKEAKVEEGNV----EIKDLCARFTTDVIGSCAFGLECNSLQDPSA 204

Zfish   206 ELVEAFEEMIKNLFSLPIDVPFSGLYRGLRARN--------FIHSKIEENIRKKIQDDD------ 256
            |    |.:..:.:|:              |.|:        |.::::...:|.|:..||      
  Fly   205 E----FRQKGREIFT--------------RRRHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFM 251

Zfish   257 ----------NENEQKYKDALQLLIENSRRSDEP------------FSLQAMKEAATELLFGGHE 299
                      .:|..|..|.::.:||......|.            .:|:.|...|......|.|
  Fly   252 STVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFE 316

Zfish   300 TTASTATSLVMFLGLNTEVVQKVREEVQEKVEMGMYTPGKGLSMELLDQLKYTGCVIKETLRINP 364
            |::||.:..:..|.|..::.|::|||::..:   ....|..|:.::|.|:.|...|:.||||.:|
  Fly   317 TSSSTMSLCLYELALQPDIQQRLREEIESVL---ANVDGGELNYDVLAQMTYLDQVLSETLRKHP 378

Zfish   365 PVPGGFRVALKTFELNGYQIP-------KGWNVIYSICDTHDVADVFPNKDEFQPERFMSKGLED 422
            .:|...|...|     .||||       ||...:..:.:.|...:::|..::|.|.||..:.:::
  Fly   379 LLPHLIRETTK-----DYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKN 438

Zfish   423 GSRFNYIPFGGGSRMCVGKEFAKVLLKIFLVELTQHCNWILSN 465
            .....|:|||.|.|.|:|..|.|:..||.||.|.:...:.:||
  Fly   439 RHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSN 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp26a1NP_571221.2 p450 14..487 CDD:299894 105/498 (21%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 105/498 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.