DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc5a and zen2

DIOPT Version :9

Sequence 1:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:104 Identity:47/104 - (45%)
Similarity:61/104 - (58%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish   133 AIKQQTNSTQRQNQSQPQIYPWM--------TKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNR 189
            ||:.:.......:.|...:||.:        |....|.|. .|||||:::..|.:|||:|||.|:
  Fly     3 AIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEK-SKRSRTAFSSLQLIELEREFHLNK 66

Zfish   190 YLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKLK 228
            ||.|.|||||:..|.|.|||:||||||||||.||.:..|
  Fly    67 YLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 34/52 (65%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.