DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbd4 and anox

DIOPT Version :10

Sequence 1:NP_001427113.1 Gene:Acbd4 / 303577 RGDID:1308404 Length:329 Species:Rattus norvegicus
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:80 Identity:29/80 - (36%)
Similarity:41/80 - (51%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    36 EMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQK---- 96
            ::|.||.||||||.|||....||......:.||.||.:||.||:..|..||:.:::.:...    
  Fly    31 DLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNWRSR 95

  Rat    97 --------VIDTVPL 103
                    .|::|||
  Fly    96 RNPGWVVHSIESVPL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbd4NP_001427113.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..170
anoxNP_001027085.1 ACBP 10..85 CDD:459982 25/53 (47%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.