DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lpl and CG6295

DIOPT Version :9

Sequence 1:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:339 Identity:88/339 - (25%)
Similarity:141/339 - (41%) Gaps:71/339 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish    48 EWM-----MDFTDIESKFSFRTLEEPEDDLCYIVPGQ--PQSIK-------DCNFNTETKTFIVI 98
            |||     ..:.:.:::...|.:..|.....|....:  ||.||       ..:||....|...|
  Fly    38 EWMDREFAEAYLETKNRMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTI 102

Zfish    99 HGWTVT-------GMFESWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAK 156
            |||:.:       |:.::|.         .....|:|.|||.......|.:|......||:.||.
  Fly   103 HGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVAT 158

Zfish   157 FVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKH-KVNRITGMDPAGPTFEYADSLSTLSPD 220
            .:|::::......:...::|:||||||:|.||...|: :::.|.|:|||.|.|.|......||..
  Fly   159 LINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSST 223

Zfish   221 DANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKC 285
            ||.:|:.:.||     ..::|..:|:|....|||||..||||.       |..||        .|
  Fly   224 DAYYVESIQTN-----GGTLGFLKPIGKGAFYPNGGKSQPGCG-------VDLTG--------SC 268

Zfish   286 SHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKMYM- 349
            :|.||:..:.:|:...:..:|  ||.   .:.:.:...|        |.:.:.:|...::..|| 
  Fly   269 AHSRSVIYYAESVTENNFPTM--RCG---DYEEAVAKEC--------GSSYSSVRMGATTNAYMV 320

Zfish   350 ------KTREMMPY 357
                  ..|...||
  Fly   321 AGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 85/330 (26%)
Pancreat_lipase_like 56..353 CDD:238363 82/320 (26%)
PLAT 360..484 CDD:294016
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 80/307 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.