DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxd3a and Antp

DIOPT Version :9

Sequence 1:NP_571200.1 Gene:hoxd3a / 30349 ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:215 Identity:78/215 - (36%)
Similarity:102/215 - (47%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


Zfish    28 PTHQGFSSSSIENDYQSPICPIQTTSVRQATHKNGDINGSCMRPSASQGNSQPESISEQQQAAP- 91
            |.|.|...:.:  .|.....| ..|.|.|..|..|........|..   .:.|:.:..|.|..| 
  Fly   198 PHHMGHPQAQL--GYTDVGVP-DVTEVHQNHHNMGMYQQQSGVPPV---GAPPQGMMHQGQGPPQ 256

Zfish    92 LAASSPSPSTNSTQKKKSPSSNGSSTATPVISKQIFPWMKETRQNAKQKSTNCPAAGETCDDKSP 156
            :....|...|..:|   :|:|..|...:|     ::|||:.  |..|            |.::  
  Fly   257 MHQGHPGQHTPPSQ---NPNSQSSGMPSP-----LYPWMRS--QFGK------------CQER-- 297

Zfish   157 PGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQK 221
                 ||.|..||..|.:||||||||||||.|.||:|:|:.|.||||||||||||||||:||:.|
  Fly   298 -----KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357

Zfish   222 SKGIMHSPLGHSPDRSPPLS 241
            :||...|. |...:.:||.|
  Fly   358 TKGEPGSG-GEGDEITPPNS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxd3aNP_571200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..163 28/135 (21%)
Abdominal-A 116..237 CDD:332641 54/120 (45%)
Antp-type hexapeptide 126..131 2/4 (50%)
Homeobox 165..217 CDD:306543 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..246 8/23 (35%)
DUF4074 333..394 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 32/142 (23%)
Homeobox 301..354 CDD:395001 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.