DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc6a and ftz

DIOPT Version :9

Sequence 1:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:226 Identity:82/226 - (36%)
Similarity:105/226 - (46%) Gaps:55/226 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish    29 TTYDSVRHFSSYGTTVTQNRIYASPFY----------SPQDNVVFGSSRGPYEYGSNVFLQDKDV 83
            ||.:.|:...:..|.||.:   .:|.|          |..::|.:.....|......:...|...
  Fly   129 TTVEQVKKAPAVSTKVTAS---PAPSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFAT 190

Zfish    84 LPSCRQTSM-------------GLNAQSHVAQEYN--LEQARAGTQDQKANNIQIYPWMQRMNSH 133
            .|....||:             |..:.|.|:||.|  :..|..|..|        :.|     ||
  Fly   191 PPPTTPTSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGD--------FNW-----SH 242

Zfish   134 SGVGYGS---DRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRM 195
            ......|   |.:|.||.|:||||||||||||||||:||||||:|||||.|:|||||||||||||
  Fly   243 IEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRM 307

Zfish   196 KWKKETNL-----------TSTVPGTESAGT 215
            |.||:..|           |:.:|..|:..|
  Fly   308 KSKKDRTLDSSPEHCGAGYTAMLPPLEATST 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 1/4 (25%)
Homeobox 146..198 CDD:278475 45/51 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 5/27 (19%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 27/134 (20%)
Homeobox 257..310 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.