Sequence 1: | NP_571198.1 | Gene: | hoxc6a / 30346 | ZFINID: | ZDB-GENE-990415-113 | Length: | 231 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477498.1 | Gene: | ftz / 40834 | FlyBaseID: | FBgn0001077 | Length: | 410 | Species: | Drosophila melanogaster |
Alignment Length: | 226 | Identity: | 82/226 - (36%) |
---|---|---|---|
Similarity: | 105/226 - (46%) | Gaps: | 55/226 - (24%) |
- Green bases have known domain annotations that are detailed below.
Zfish 29 TTYDSVRHFSSYGTTVTQNRIYASPFY----------SPQDNVVFGSSRGPYEYGSNVFLQDKDV 83
Zfish 84 LPSCRQTSM-------------GLNAQSHVAQEYN--LEQARAGTQDQKANNIQIYPWMQRMNSH 133
Zfish 134 SGVGYGS---DRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRM 195
Zfish 196 KWKKETNL-----------TSTVPGTESAGT 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hoxc6a | NP_571198.1 | Antp-type hexapeptide | 123..128 | 1/4 (25%) | |
Homeobox | 146..198 | CDD:278475 | 45/51 (88%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..231 | 5/27 (19%) | |||
ftz | NP_477498.1 | FTZ | 1..248 | CDD:281812 | 27/134 (20%) |
Homeobox | 257..310 | CDD:278475 | 45/52 (87%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |