DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc4a and Antp

DIOPT Version :9

Sequence 1:NP_571197.1 Gene:hoxc4a / 30345 ZFINID:ZDB-GENE-990415-112 Length:268 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:197 Identity:80/197 - (40%)
Similarity:101/197 - (51%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


Zfish    29 IPE-HSPEYYSRARDSGYQHHHQELYPPRASYQERQYNCASIPEPDTQRGHGLPHAGHLLGKGQS 92
            :|| .||....:.  ||:..:.|...|....:.:.|.....:..||....|   ...|.:|..|.
  Fly   174 VPEGGSPPLVDQM--SGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVH---QNHHNMGMYQQ 233

Zfish    93 ASCEPP-------PLPLSPATPSAASSACNQATP--EHPNSSASAKQPVVYPWMKKIHVSTVNSS 148
            .|..||       .:......|........|.||  ::|||.:|.....:||||:        |.
  Fly   234 QSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR--------SQ 290

Zfish   149 YNGA-EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLVLSERQIKIWFQNRRMKWKKD 212
            :... |.||.|..|||.|.||||||||:||||||||||||||:|.|:|||||||||||||||||:
  Fly   291 FGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355

Zfish   213 HR 214
            ::
  Fly   356 NK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc4aNP_571197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..129 17/67 (25%)
Antp-type hexapeptide 133..138 3/4 (75%)
Homeobox 157..210 CDD:278475 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 0/3 (0%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/144 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.