DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc4a and zen2

DIOPT Version :9

Sequence 1:NP_571197.1 Gene:hoxc4a / 30345 ZFINID:ZDB-GENE-990415-112 Length:268 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:133 Identity:50/133 - (37%)
Similarity:77/133 - (57%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


Zfish   127 SAKQPVVYPWMK-KIHVSTVNSSYNGAEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHS 190
            |....::||.:: .:..:...::.:..:.||||||::..|::|||:|||.|:||.|.|||||:..
  Fly    15 SVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQR 79

Zfish   191 LVLSERQIKIWFQNRRMKWKKDHRLPNTKVRSSSSTGISSGSNTSSAAGVVAAASTTNTMS--AS 253
            |.|:|||:||||||||||.||                      :::..|.:.|.:|:..:|  :|
  Fly    80 LALTERQVKIWFQNRRMKLKK----------------------STNRKGAIGALTTSIPLSSQSS 122

Zfish   254 EDL 256
            |||
  Fly   123 EDL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc4aNP_571197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..129 1/1 (100%)
Antp-type hexapeptide 133..138 2/4 (50%)
Homeobox 157..210 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 8/47 (17%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.