DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxc4a and unpg

DIOPT Version :9

Sequence 1:NP_571197.1 Gene:hoxc4a / 30345 ZFINID:ZDB-GENE-990415-112 Length:268 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:251 Identity:73/251 - (29%)
Similarity:102/251 - (40%) Gaps:61/251 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish    22 EYSQNSYIPEHSPEYYSRARD---SGYQHHH---------QELYPPRASYQERQYNCASIPEP-- 72
            |.....|:  ||...::|.:.   :|..|..         ||..||:|.....:....|..||  
  Fly   179 ELMNQDYV--HSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPAL 241

Zfish    73 DTQRGHGLPHAGHLLGKGQSASCEPPPLPLSP-------------ATPSAASSACNQ---ATPEH 121
            |.........:|.        ||....|.:||             |..::.|..|:.   |...|
  Fly   242 DVGMDEDFECSGD--------SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298

Zfish   122 PNSSASAKQPVVYPWMKKIHVSTVNSSYNGAEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIE 186
            .......|.            |..|.|.:.::.:|.|||:|.:|:||||:|||..:||:...|.:
  Fly   299 EGGGMGGKD------------SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQ 351

Zfish   187 IAHSLVLSERQIKIWFQNRRMKWKKDHRLPNTKVRSS-SSTGISSGSNTSSAAGVV 241
            ||.||.|||.|:||||||||.|||        :|::. :|.|:.....||....||
  Fly   352 IATSLKLSEVQVKIWFQNRRAKWK--------RVKAGLTSHGLGRNGTTSGTKIVV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxc4aNP_571197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..129 14/76 (18%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:278475 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 7/31 (23%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.