DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb8a and ey

DIOPT Version :9

Sequence 1:XP_005171620.1 Gene:hoxb8a / 30343 ZFINID:ZDB-GENE-990415-108 Length:246 Species:Danio rerio
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:95/254 - (37%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


Zfish    21 PNYYECGFAQDLGTR---PTVVYGPGTGATFQHAPQIQEFYHHGAS----TLSAAPYQQSP--CA 76
            ||:        ||||   |.:|:| ...|..||..|.....|:..|    :||..|...:|  .:
  Fly   332 PNH--------LGTRSSHPQLVHG-NHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIAS 387

Zfish    77 VTCHGE----------PGNFYGYDAL--QRQTLFGAQDADLVQYSDCKLATGGIGDET------- 122
            ||.:..          |.:.....::  ||......:|..|.:..|     |...|||       
  Fly   388 VTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELD-----GHQSDETGSGEGEN 447

Zfish   123 --------DNTEQSPSPTQLFPWMRPQVAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEV 179
                    .|||...:        |..:....:|.|.:::..|...|||||....|.....|..:
  Fly   448 SNGGASNIGNTEDDQA--------RLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERL 504

Zfish   180 SHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKSEQEQIEKEKREKEQ--ASGTQSA 236
            :..:||.|.::::||.|||.||::|             |::..::|....  ||.|.|:
  Fly   505 AGKIGLPEARIQVWFSNRRAKWRRE-------------EKLRNQRRTPNSTGASATSSS 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb8aXP_005171620.1 Homeobox 150..202 CDD:278475 18/51 (35%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.