DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb8a and Scr

DIOPT Version :9

Sequence 1:XP_005171620.1 Gene:hoxb8a / 30343 ZFINID:ZDB-GENE-990415-108 Length:246 Species:Danio rerio
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:160 Identity:68/160 - (42%)
Similarity:90/160 - (56%) Gaps:42/160 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    59 HHGASTLSAAPYQQSPCAVTCHGEPGNFYGYDALQRQTLFGAQDADLVQYSDCKLATGGIGDETD 123
            :|..|.:|..|...:   |..| .||.             |..|::    ||.       |:|..
  Fly   253 NHSGSGVSGGPGNVN---VPMH-SPGG-------------GDSDSE----SDS-------GNEAG 289

Zfish   124 NTEQS----PSPTQLFPWMRPQVAAG---------RRRGRQTYSRYQTLELEKEFLFNPYLTRKR 175
            :::.|    .:|.|::|||: :|..|         .:|.|.:|:|||||||||||.||.||||:|
  Fly   290 SSQNSGNGKKNPPQIYPWMK-RVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRR 353

Zfish   176 RIEVSHALGLTERQVKIWFQNRRMKWKKEN 205
            |||::|||.|||||:||||||||||||||:
  Fly   354 RIEIAHALCLTERQIKIWFQNRRMKWKKEH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb8aXP_005171620.1 Homeobox 150..202 CDD:278475 41/51 (80%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.