DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf43 and HRD1

DIOPT Version :9

Sequence 1:XP_006247152.1 Gene:Rnf43 / 303412 RGDID:1305204 Length:802 Species:Rattus norvegicus
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:14/65 - (21%)
Similarity:33/65 - (50%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat   264 SSSSSAPVCAICLEEF----------TEGQELRVISCLHEFHRTCVDPWLHQHRTCPLCMFNIVE 318
            :|::...:|.||::|.          .:.::.:.:.|.|..|.:|:..|:.:.:|||:|...:.:
Yeast   341 NSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFD 405

  Rat   319  318
            Yeast   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf43XP_006247152.1 ZNRF_3_ecto 85..187 CDD:408039
RING-H2_RNF43 270..316 CDD:319712 13/55 (24%)
dnaA 598..>743 CDD:237605
HRD1NP_014630.1 HRD1 5..551 CDD:227568 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.