DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb6a and Ubx

DIOPT Version :9

Sequence 1:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:265 Identity:91/265 - (34%)
Similarity:110/265 - (41%) Gaps:90/265 - (33%)


- Green bases have known domain annotations that are detailed below.


Zfish    17 GQESFLGQIPLYSS---------GYTD-----PLRHYPGAAYGGSSVQEKAYPSSFYQQANGAYS 67
            ||.:..|.:|:..|         ||.|     |:.|..|:|.|..||      |.....|.|..|
  Fly   143 GQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSV------SGGNGNAGGVQS 201

Zfish    68 RATAAGPCDYATASFYREKDPACALASIEEHSFVLSQDHRKTDCTGSTGKSIYPEADEQKPSAPV 132
            ....||......|:        |.::.....:...|..|:.::.|                   .
  Fly   202 GVGVAGAGTAWNAN--------CTISGAAAQTAAASSLHQASNHT-------------------F 239

Zfish   133 YPWMQRMNSCN---------------------------------------GTFGNAGRRGRQTYT 158
            ||||.....|.                                       ||.| ..||||||||
  Fly   240 YPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNG-LRRRGRQTYT 303

Zfish   159 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLINCSQTSGEEEE 223
            ||||||||||||.|.|||||||||:|||||||||||||||||||||.|||   |...:...|:|:
  Fly   304 RYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE---IQAIKELNEQEK 365

Zfish   224 EKRTE 228
            :.:.:
  Fly   366 QAQAQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 3/4 (75%)
Homeobox 154..206 CDD:278475 48/51 (94%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.