DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb6a and Antp

DIOPT Version :9

Sequence 1:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:229 Identity:96/229 - (41%)
Similarity:117/229 - (51%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MSSYFLNSTFPVTLPGGQESFLGQIPLYSSGYTDPLRHYPGAAYGGSSVQEKAYPSSFYQQANGA 65
            ||.:.:|:  .:|||    ..:|. |....||||.  ..|..    :.|.:..:....|||.:|.
  Fly   186 MSGHHMNA--QMTLP----HHMGH-PQAQLGYTDV--GVPDV----TEVHQNHHNMGMYQQQSGV 237

Zfish    66 YSRATAAGPCDYATASFYREKDPACALASIEEHSFVLSQDHRKTDCTGSTGKSIYPEADEQKPS- 129
              ....|.|    ....::.:.|              .|.|:     |..|:...|..:....| 
  Fly   238 --PPVGAPP----QGMMHQGQGP--------------PQMHQ-----GHPGQHTPPSQNPNSQSS 277

Zfish   130 ---APVYPWMQRMNSCNGTFGNA--GRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 189
               :|:||||:      ..||..  .:||||||||||||||||||||||||||||||||||||||
  Fly   278 GMPSPLYPWMR------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 336

Zfish   190 TERQIKIWFQNRRMKWKKENKLINCSQTSGEEEE 223
            |||||||||||||||||||||......:.||.:|
  Fly   337 TERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 3/4 (75%)
Homeobox 154..206 CDD:278475 51/51 (100%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 40/163 (25%)
Homeobox 301..354 CDD:395001 52/52 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5620
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.