DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb6a and ftz

DIOPT Version :9

Sequence 1:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:191 Identity:74/191 - (38%)
Similarity:93/191 - (48%) Gaps:27/191 - (14%)


- Green bases have known domain annotations that are detailed below.


Zfish    48 SVQEKAYPSSFYQQANGAYSRATAAGPCDYATASFYREKDPACALASIEEHSFVLSQDHRKTDCT 112
            |.:..|.|:..|.|........:|:...||...     ..|......::...|........|...
  Fly   141 STKVTASPAPSYDQEYVTVPTPSASEDVDYLDV-----YSPQSQTQKLKNGDFATPPPTTPTSLP 200

Zfish   113 GSTGKSIYPEADEQKPSAPVYPWMQRMNSCNGTFGN-AG------------------RRGRQTYT 158
            ...|.|..|::..:|.|:.|   .|.:|....|..| ||                  :|.|||||
  Fly   201 PLEGISTPPQSPGEKSSSAV---SQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYT 262

Zfish   159 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLINCSQTSG 219
            ||||||||||||||||:||||||:||:||.|:||||||||||||||.||:..|.:..:..|
  Fly   263 RYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 1/4 (25%)
Homeobox 154..206 CDD:278475 46/51 (90%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 23/114 (20%)
Homeobox 257..310 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.