DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb4a and ftz

DIOPT Version :9

Sequence 1:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:254 Identity:86/254 - (33%)
Similarity:111/254 - (43%) Gaps:75/254 - (29%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 SYLINSNYVDPKFPPCEEYSQSDYLPSHSPDYYSAQRQDPSFQHESIYHQRSGCADPPYSSCQGP 69
            ||  :..||....|...|  ..|||     |.||.|.|....::...       |.||       
  Fly   151 SY--DQEYVTVPTPSASE--DVDYL-----DVYSPQSQTQKLKNGDF-------ATPP------- 192

Zfish    70 GQPAAVISPRGHVLPTTALSTPLPEPSHHCDSVTPSPPPACGQTPTSQNTSTVSSRKDPVVYPWM 134
                          |||..|.|..|..        |.||   |:|..:::|.||...:       
  Fly   193 --------------PTTPTSLPPLEGI--------STPP---QSPGEKSSSAVSQEIN------- 225

Zfish   135 KKVHVNIVSPNYSGG---------------EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEI 184
               |..:.:||.:|.               :.||:|..|||.|.||||||||:|||:|||||::|
  Fly   226 ---HRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDI 287

Zfish   185 AHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSNSASTNSSGCPTLCSNQSRASGPP 243
            |:.|.||||||||||||||||.|||..|.::.....:..|  :..|.|.:..:..:|.|
  Fly   288 ANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCGAGYT--AMLPPLEATSTATTGAP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 25/101 (25%)
Antp-type hexapeptide 130..135 0/4 (0%)
Homeobox 154..207 CDD:278475 40/52 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 6/34 (18%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 35/154 (23%)
Homeobox 257..310 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.