DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb4a and Scr

DIOPT Version :9

Sequence 1:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:166 Identity:77/166 - (46%)
Similarity:98/166 - (59%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


Zfish    53 HQRSGCADPPYSSCQGPGQPAAVISPRGHVLPTTALSTPLPEP-SHHCDSVTPSPPPACGQTPTS 116
            |..||.:.       |||.                ::.|:..| ....||.:.|.    .:..:|
  Fly   254 HSGSGVSG-------GPGN----------------VNVPMHSPGGGDSDSESDSG----NEAGSS 291

Zfish   117 QNTSTVSSRKDPVVYPWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRR 181
            ||:.. ..:..|.:|||||:||:...:.| :.||.||.||:|||.|.||||||||:|||||||||
  Fly   292 QNSGN-GKKNPPQIYPWMKRVHLGTSTVN-ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRR 354

Zfish   182 VEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKI 217
            :||||.|||:|||||||||||||||||:||:.:..|
  Fly   355 IEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 14/72 (19%)
Antp-type hexapeptide 130..135 3/4 (75%)
Homeobox 154..207 CDD:278475 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 3/8 (38%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.