Sequence 1: | NP_571191.1 | Gene: | hoxb2a / 30338 | ZFINID: | ZDB-GENE-990415-103 | Length: | 390 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
Alignment Length: | 258 | Identity: | 82/258 - (31%) |
---|---|---|---|
Similarity: | 110/258 - (42%) | Gaps: | 85/258 - (32%) |
- Green bases have known domain annotations that are detailed below.
Zfish 158 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTTHHRD 222
Zfish 223 GQEGEPSGFDLLEGTDASSPYSSQSLEVSGSGSAAPSESETCPTTAAYTNSSDKSQP-------T 280
Zfish 281 PEEGQAS------------QPEPASVPDTAVHSPPY---------------PT-PTADNPTTMAE 317
Zfish 318 GRAAGPEHSFTEPQDATSLPDLNFFSTDSCLQISDALSPSLQSSLDSPVDFSEEDFDLFTSTL 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hoxb2a | NP_571191.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..73 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..100 | ||||
Antp-type hexapeptide | 103..108 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 108..155 | ||||
Homeobox | 162..214 | CDD:278475 | 36/51 (71%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 211..338 | 35/161 (22%) | |||
zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 36/52 (69%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |